Recombinant Full Length Human COQ7 Protein, GST-tagged
| Cat.No. : | COQ7-1978HF |
| Product Overview : | Human COQ7 full-length ORF ( NP_057222.2, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 217 amino acids |
| Description : | The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010] |
| Molecular Mass : | 50.7 kDa |
| AA Sequence : | MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COQ7 coenzyme Q7 homolog, ubiquinone (yeast) [ Homo sapiens ] |
| Official Symbol | COQ7 |
| Synonyms | COQ7; coenzyme Q7 homolog, ubiquinone (yeast); coenzyme Q, 7 (rat, yeast) homolog; ubiquinone biosynthesis protein COQ7 homolog; CAT5; CLK 1; placental protein KG-20; timing protein clk-1 homolog; COQ7 coenzyme Q, 7 homolog ubiquinone; coenzyme Q biosynthesis protein 7 homolog; CLK1; CLK-1 |
| Gene ID | 10229 |
| mRNA Refseq | NM_001190983 |
| Protein Refseq | NP_001177912 |
| MIM | 601683 |
| UniProt ID | Q99807 |
| ◆ Recombinant Proteins | ||
| COQ7-11473H | Recombinant Human COQ7, GST-tagged | +Inquiry |
| COQ7-3312H | Recombinant Human COQ7 Protein, MYC/DDK-tagged | +Inquiry |
| COQ7-900H | Recombinant Human COQ7 protein, His-tagged | +Inquiry |
| COQ7-4751C | Recombinant Chicken COQ7 | +Inquiry |
| COQ7-1900M | Recombinant Mouse COQ7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COQ7-2006HCL | Recombinant Human COQ7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COQ7 Products
Required fields are marked with *
My Review for All COQ7 Products
Required fields are marked with *
