Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human CSRP1 Protein

Cat.No. : CSRP1-98HF
Product Overview : Recombinant full length Human CSRP1 with an N terminal proprietary tag; Predicted MWt 47.3 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 47.300kDa inclusive of tags
Protein Length : 193 amino acids
AA Sequence : MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVC KKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTL STDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLAD KDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ]
Official Symbol : CSRP1
Synonyms : CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E
Gene ID : 1465
mRNA Refseq : NM_001193570
Protein Refseq : NP_001180499
MIM : 123876
UniProt ID : P21291

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends