Recombinant Full Length Human CSRP1 Protein

Cat.No. : CSRP1-98HF
Product Overview : Recombinant full length Human CSRP1 with an N terminal proprietary tag; Predicted MWt 47.3 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 193 amino acids
Description : This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described.
Form : Liquid
Molecular Mass : 47.300kDa inclusive of tags
AA Sequence : MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVC KKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTL STDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLAD KDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ]
Official Symbol CSRP1
Synonyms CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E
Gene ID 1465
mRNA Refseq NM_001193570
Protein Refseq NP_001180499
MIM 123876
UniProt ID P21291

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSRP1 Products

Required fields are marked with *

My Review for All CSRP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon