Recombinant Full Length Human CSRP1 Protein
| Cat.No. : | CSRP1-98HF |
| Product Overview : | Recombinant full length Human CSRP1 with an N terminal proprietary tag; Predicted MWt 47.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 193 amino acids |
| Description : | This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. |
| Form : | Liquid |
| Molecular Mass : | 47.300kDa inclusive of tags |
| AA Sequence : | MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVC KKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTL STDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLAD KDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ] |
| Official Symbol | CSRP1 |
| Synonyms | CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E |
| Gene ID | 1465 |
| mRNA Refseq | NM_001193570 |
| Protein Refseq | NP_001180499 |
| MIM | 123876 |
| UniProt ID | P21291 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSRP1 Products
Required fields are marked with *
My Review for All CSRP1 Products
Required fields are marked with *
