Recombinant Full Length Human CSRP1 Protein
Cat.No. : | CSRP1-98HF |
Product Overview : | Recombinant full length Human CSRP1 with an N terminal proprietary tag; Predicted MWt 47.3 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 47.300kDa inclusive of tags |
Protein Length : | 193 amino acids |
AA Sequence : | MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVC KKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTL STDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLAD KDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ] |
Official Symbol : | CSRP1 |
Synonyms : | CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E |
Gene ID : | 1465 |
mRNA Refseq : | NM_001193570 |
Protein Refseq : | NP_001180499 |
MIM : | 123876 |
UniProt ID : | P21291 |
Products Types
◆ Recombinant Protein | ||
Csrp1-2343M | Recombinant Mouse Csrp1 Protein, Myc/DDK-tagged | +Inquiry |
CSRP1-2017H | Recombinant Human CSRP1 Protein, GST-tagged | +Inquiry |
CSRP1-891R | Recombinant Rhesus Macaque CSRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSRP1-2030M | Recombinant Mouse CSRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSRP1-674H | Recombinant Human CSRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CSRP1-7233HCL | Recombinant Human CSRP1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket