Recombinant Full Length Human FIS1 Protein, GST-tagged

Cat.No. : FIS1-5115HF
Product Overview : Human FIS1 full-length ORF ( AAH03540.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 152 amino acids
Description : The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM
Molecular Mass : 42.46 kDa
AA Sequence : MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FIS1 fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol FIS1
Synonyms FIS1; fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae); fission 1 (mitochondrial outer membrane) homolog (yeast), tetratricopeptide repeat domain 11, TTC11; mitochondrial fission 1 protein; CGI 135; CGI 135 protein; Fis1; H_NH0132A01.6; hFis1; FIS1 homolog; TPR repeat protein 11; tetratricopeptide repeat domain 11; tetratricopeptide repeat protein 11; TTC11; CGI-135;
Gene ID 51024
mRNA Refseq NM_016068
Protein Refseq NP_057152
MIM 609003
UniProt ID Q9Y3D6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FIS1 Products

Required fields are marked with *

My Review for All FIS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon