Recombinant Full Length Human GALP Protein, GST-tagged
| Cat.No. : | GALP-5373HF |
| Product Overview : | Human GALP full-length ORF ( AAI48723.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 116 amino acids |
| Description : | This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, may have vasoactive properties and serve as a marker for neuroblastic tumors |
| Molecular Mass : | 39.71 kDa |
| AA Sequence : | MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GALP galanin-like peptide [ Homo sapiens ] |
| Official Symbol | GALP |
| Synonyms | GALP; galanin-like peptide; alarin; gal-like peptide; |
| Gene ID | 85569 |
| mRNA Refseq | NM_001145546 |
| Protein Refseq | NP_001139018 |
| MIM | 611178 |
| UniProt ID | Q9UBC7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALP Products
Required fields are marked with *
My Review for All GALP Products
Required fields are marked with *



