Recombinant Full Length Human GALP Protein, GST-tagged
Cat.No. : | GALP-5373HF |
Product Overview : | Human GALP full-length ORF ( AAI48723.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 116 amino acids |
Description : | This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, may have vasoactive properties and serve as a marker for neuroblastic tumors |
Molecular Mass : | 39.71 kDa |
AA Sequence : | MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GALP galanin-like peptide [ Homo sapiens ] |
Official Symbol | GALP |
Synonyms | GALP; galanin-like peptide; alarin; gal-like peptide; |
Gene ID | 85569 |
mRNA Refseq | NM_001145546 |
Protein Refseq | NP_001139018 |
MIM | 611178 |
UniProt ID | Q9UBC7 |
◆ Recombinant Proteins | ||
GALP-6196M | Recombinant Mouse GALP Protein | +Inquiry |
GALP-4713H | Recombinant Human GALP Protein, GST-tagged | +Inquiry |
GALP-3458M | Recombinant Mouse GALP Protein, His (Fc)-Avi-tagged | +Inquiry |
GALP-2791H | Recombinant Human GALP Protein (Arg29-Ser116), N-GST tagged | +Inquiry |
GALP-5790H | Recombinant Human GALP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALP-6029HCL | Recombinant Human GALP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALP Products
Required fields are marked with *
My Review for All GALP Products
Required fields are marked with *