Recombinant Full Length Human GALP Protein, GST-tagged

Cat.No. : GALP-5373HF
Product Overview : Human GALP full-length ORF ( AAI48723.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 116 amino acids
Description : This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, may have vasoactive properties and serve as a marker for neuroblastic tumors
Molecular Mass : 39.71 kDa
AA Sequence : MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GALP galanin-like peptide [ Homo sapiens ]
Official Symbol GALP
Synonyms GALP; galanin-like peptide; alarin; gal-like peptide;
Gene ID 85569
mRNA Refseq NM_001145546
Protein Refseq NP_001139018
MIM 611178
UniProt ID Q9UBC7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GALP Products

Required fields are marked with *

My Review for All GALP Products

Required fields are marked with *

0
cart-icon