Recombinant Full Length Human GCHFR Protein, GST-tagged

• Cat.No.: GCHFR-5171HF
• Product Overview: Human GCHFR full-length ORF ( NP_005249.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 84 amino acids
• Description: GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. [provided by RefSeq
• Molecular Mass: 36.1 kDa
• AA Sequence: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GCHFR GTP cyclohydrolase I feedback regulator [ Homo sapiens ]
• Official Symbol: GCHFR
• Synonyms: GCHFR; GTP cyclohydrolase I feedback regulator; GTP cyclohydrolase I feedback regulatory protein; GTP cyclohydrolase 1 feedback regulatory protein; GFRP; HsT16933; P35; MGC138467; MGC138469
• Gene ID: 2644
• mRNA Refseq: NM_005258
• Protein Refseq: NP_005249
• MIM: 602437
• UniProt ID: P30047