Recombinant Full Length Human GLRX5 Protein, GST-tagged

Cat.No. : GLRX5-5349HF
Product Overview : Human GLRX5 full-length ORF ( NP_057501.2, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 157 amino acids
Description : This gene encodes a mitochondrial protein, which is evolutionarily conserved. It is involved in the biogenesis of iron-sulfur clusters, which are required for normal iron homeostasis. Mutations in this gene are associated with autosomal recessive pyridoxine-refractory sideroblastic anemia. [provided by RefSeq, May 2010]
Molecular Mass : 43 kDa
AA Sequence : MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLRX5 glutaredoxin 5 [ Homo sapiens ]
Official Symbol GLRX5
Synonyms GLRX5; glutaredoxin 5; C14orf87, chromosome 14 open reading frame 87, glutaredoxin 5 homolog (S. cerevisiae); glutaredoxin-related protein 5, mitochondrial; GRX5; PR01238; glutaredoxin 5 homolog; monothiol glutaredoxin-5; FLB4739; PRO1238; C14orf87; MGC14129;
Gene ID 51218
mRNA Refseq NM_016417
Protein Refseq NP_057501
MIM 609588
UniProt ID Q86SX6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLRX5 Products

Required fields are marked with *

My Review for All GLRX5 Products

Required fields are marked with *

0
cart-icon