Recombinant Full Length Human GPR162 Protein, GST-tagged
Cat.No. : | GPR162-5475HF |
Product Overview : | Human GPR162 full-length ORF ( NP_055264.1, 1 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 304 amino acids |
Description : | This gene was identified upon genomic analysis of a gene-dense region at human chromosome 12p13. It appears to be mainly expressed in the brain; however, its function is not known. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq |
Molecular Mass : | 59.5 kDa |
AA Sequence : | MLSTGVVSFFSLKSDSAPPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDGDDDGGCDDYAEGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLRQFLESGVLGSGGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSLGSPESRAVGLPLGLSAGRRCSLTGGEESARAWGGSWGPGNPIFPQLTL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR162 G protein-coupled receptor 162 [ Homo sapiens ] |
Official Symbol | GPR162 |
Synonyms | A-2; GRCA; GPR162; G protein-coupled receptor 162 |
Gene ID | 27239 |
mRNA Refseq | NM_019858 |
Protein Refseq | NP_062832 |
UniProt ID | Q16538 |
◆ Recombinant Proteins | ||
RFL12934MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 162(Gpr162) Protein, His-Tagged | +Inquiry |
GPR162-1766R | Recombinant Rhesus Macaque GPR162 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR162-5474HF | Recombinant Full Length Human GPR162 Protein | +Inquiry |
GPR162-1945R | Recombinant Rhesus monkey GPR162 Protein, His-tagged | +Inquiry |
GPR162-7161M | Recombinant Mouse GPR162 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR162-742HCL | Recombinant Human GPR162 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR162 Products
Required fields are marked with *
My Review for All GPR162 Products
Required fields are marked with *
0
Inquiry Basket