Recombinant Full Length Human GTF2A2 Protein, GST-tagged

Cat.No. : GTF2A2-3374HF
Product Overview : Human GTF2A2 full-length ORF ( AAH00287, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 109 amino acids
Description : Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM
Molecular Mass : 37.73 kDa
AA Sequence : MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTF2A2 general transcription factor IIA, 2, 12kDa [ Homo sapiens ]
Official Symbol GTF2A2
Synonyms GTF2A2; general transcription factor IIA, 2, 12kDa; general transcription factor IIA, 2 (12kD subunit); transcription initiation factor IIA subunit 2; HsT18745; TFIIA; TFIIAS; TFIIA-12; TFIIA-gamma; TFIIA p12 subunit; general transcription factor IIA subunit 2; transcription initiation factor IIA gamma chain; TF2A2;
Gene ID 2958
mRNA Refseq NM_004492
Protein Refseq NP_004483
MIM 600519
UniProt ID P52657

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTF2A2 Products

Required fields are marked with *

My Review for All GTF2A2 Products

Required fields are marked with *

0
cart-icon