Recombinant Full Length Human HIST1H2AA Protein, GST-tagged
Cat.No. : | HIST1H2AA-3567HF |
Product Overview : | Human HIST1H2AA full-length ORF (AAH62211.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 131 amino acids |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq |
Molecular Mass : | 40.81 kDa |
AA Sequence : | MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHHHKAQSK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIST1H2AA histone cluster 1, H2aa [ Homo sapiens ] |
Official Symbol | HIST1H2AA |
Synonyms | HIST1H2AA; histone cluster 1, H2aa; H2A histone family, member R , histone 1, H2aa; histone H2A type 1-A; bA317E16.2; H2AFR; histone H2A/r; histone 1, H2aa; H2A histone family, member R; H2AA; |
Gene ID | 221613 |
mRNA Refseq | NM_170745 |
Protein Refseq | NP_734466 |
MIM | 613499 |
UniProt ID | Q96QV6 |
◆ Recombinant Proteins | ||
HIST1H2AA-4776H | Recombinant Human HIST1H2AA Protein, GST-tagged | +Inquiry |
HIST1H2AA-1910R | Recombinant Rhesus Macaque HIST1H2AA Protein, His (Fc)-Avi-tagged | +Inquiry |
HIST1H2AA-2089R | Recombinant Rhesus monkey HIST1H2AA Protein, His-tagged | +Inquiry |
HIST1H2AA-2507R | Recombinant Rat HIST1H2AA Protein, His (Fc)-Avi-tagged | +Inquiry |
HIST1H2AA-3567HF | Recombinant Full Length Human HIST1H2AA Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H2AA-5550HCL | Recombinant Human HIST1H2AA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIST1H2AA Products
Required fields are marked with *
My Review for All HIST1H2AA Products
Required fields are marked with *
0
Inquiry Basket