Recombinant Full Length Human HNRNPA0 Protein, GST-tagged
Cat.No. : | HNRNPA0-3678HF |
Product Overview : | Human HNRNPA0 full-length ORF ( NP_006796.1, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 305 amino acids |
Description : | This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus. [provided by RefSeq |
Molecular Mass : | 57.2 kDa |
AA Sequence : | MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGYNSYGGYGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSSWGGRSNSGPYRGGYGGGGGYGGSSF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HNRNPA0 heterogeneous nuclear ribonucleoprotein A0 [ Homo sapiens ] |
Official Symbol | HNRNPA0 |
Synonyms | HNRPA0 |
Gene ID | 10949 |
mRNA Refseq | NM_006805 |
Protein Refseq | NP_006796 |
MIM | 609409 |
UniProt ID | Q13151 |
◆ Recombinant Proteins | ||
HNRNPA0-4021H | Recombinant Human HNRNPA0 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HNRNPA0-3678HF | Recombinant Full Length Human HNRNPA0 Protein, GST-tagged | +Inquiry |
HNRNPA0-7755M | Recombinant Mouse HNRNPA0 Protein | +Inquiry |
HNRNPA0-4900H | Recombinant Human HNRNPA0 Protein, GST-tagged | +Inquiry |
HNRNPA0-13864H | Recombinant Human HNRNPA0 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPA0-5454HCL | Recombinant Human HNRNPA0 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPA0 Products
Required fields are marked with *
My Review for All HNRNPA0 Products
Required fields are marked with *