Recombinant Full Length Human Integral Membrane Protein 2C(Itm2C) Protein, His-Tagged
Cat.No. : | RFL29413HF |
Product Overview : | Recombinant Full Length Human Integral membrane protein 2C(ITM2C) Protein (Q9NQX7) (1-267aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-267) |
Form : | Lyophilized powder |
AA Sequence : | MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAREEQPPQHRSKRGGSVGGVCY LSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFRCGVLYEDSLSSQVRTQMELEEDVKI YLDENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFW ELLMNVKRGTYLPQTYIIQEEMVVTEHVSDKEALGSFIYHLCNGKDTYRLRRRATRRRIN KRGAKNCNAIRHFENTFVVETLICGVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ITM2C |
Synonyms | ITM2C; BRI3; hucep-14; NPD018; PSEC0047; Integral membrane protein 2C; Cerebral protein 14; Transmembrane protein BRI3 |
UniProt ID | Q9NQX7 |
◆ Recombinant Proteins | ||
ITM2C-8383M | Recombinant Mouse ITM2C Protein | +Inquiry |
ITM2C-4822C | Recombinant Chicken ITM2C | +Inquiry |
RFL12066PF | Recombinant Full Length Pongo Abelii Integral Membrane Protein 2C(Itm2C) Protein, His-Tagged | +Inquiry |
RFL27762RF | Recombinant Full Length Rat Integral Membrane Protein 2C(Itm2C) Protein, His-Tagged | +Inquiry |
ITM2C-3121R | Recombinant Rat ITM2C Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITM2C-5115HCL | Recombinant Human ITM2C 293 Cell Lysate | +Inquiry |
ITM2C-5114HCL | Recombinant Human ITM2C 293 Cell Lysate | +Inquiry |
ITM2C-5116HCL | Recombinant Human ITM2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITM2C Products
Required fields are marked with *
My Review for All ITM2C Products
Required fields are marked with *