Recombinant Full Length Human Kiss-1 Receptor(Kiss1R) Protein, His-Tagged
Cat.No. : | RFL33649HF |
Product Overview : | Recombinant Full Length Human KiSS-1 receptor(KISS1R) Protein (Q969F8) (1-398aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-398) |
Form : | Lyophilized powder |
AA Sequence : | MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGN SLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNY IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL HRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAP ADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYA AYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPH AELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KISS1R |
Synonyms | KISS1R; AXOR12; GPR54; KiSS-1 receptor; KiSS-1R; G-protein coupled receptor 54; G-protein coupled receptor OT7T175; hOT7T175; Hypogonadotropin-1; Kisspeptins receptor; Metastin receptor |
UniProt ID | Q969F8 |
◆ Recombinant Proteins | ||
RFL14271MF | Recombinant Full Length Mouse Kiss-1 Receptor(Kiss1R) Protein, His-Tagged | +Inquiry |
RFL23758RF | Recombinant Full Length Rat Kiss-1 Receptor(Kiss1R) Protein, His-Tagged | +Inquiry |
KISS1R-388C | Recombinant Cynomolgus Monkey KISS1R Protein, His (Fc)-Avi-tagged | +Inquiry |
KISS1R-642C | Recombinant Cynomolgus KISS1R Protein, His-tagged | +Inquiry |
KISS1R-2920R | Recombinant Rat KISS1R Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KISS1R Products
Required fields are marked with *
My Review for All KISS1R Products
Required fields are marked with *
0
Inquiry Basket