Recombinant Full Length Human KLHDC2 Protein, C-Flag-tagged
Cat.No. : | KLHDC2-828HFL |
Product Overview : | Recombinant Full Length Human KLHDC2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables ubiquitin ligase-substrate adaptor activity. Involved in ubiquitin-dependent protein catabolic process via the C-end degron rule pathway. Located in nuclear body and nuclear membrane. Is active in Cul2-RING ubiquitin ligase complex and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.9 kDa |
AA Sequence : | MADGNEDLRADDLPGPAFESYESMELACPAERSGHVAVSDGRHMFVWGGYKSNQVRGLYDFYLPREELWI YNMETGRWKKINTEGDVPPSMSGSCAVCVDRVLYLFGGHHSRGNTNKFYMLDSRSTDRVLQWERIDCQGI PPSSKDKLGVWVYKNKLIFFGGYGYLPEDKVLGTFEFDETSFWNSSHPRGWNDHVHILDTETFTWSQPIT TGKAPSPRAAHACATVGNRGFVFGGRYRDARMNDLHYLNLDTWEWNELIPQGICPVGRSWHSLTPVSSDH LFLFGGFTTDKQPLSDAWTYCISKNEWIQFNHPYTEKPRLWHTACASDEGEVIVFGGCANNLLVHHRAAH SNEILIFSVQPKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | KLHDC2 kelch domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | KLHDC2 |
Synonyms | LCP; HCLP1; HCLP-1 |
Gene ID | 23588 |
mRNA Refseq | NM_014315.3 |
Protein Refseq | NP_055130.1 |
MIM | 611280 |
UniProt ID | Q9Y2U9 |
◆ Recombinant Proteins | ||
KLHDC2-2930R | Recombinant Rat KLHDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLHDC2-1251H | Recombinant Human KLHDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLHDC2-404H | Recombinant Human KLHDC2, His-tagged | +Inquiry |
Klhdc2-3704M | Recombinant Mouse Klhdc2 Protein, Myc/DDK-tagged | +Inquiry |
KLHDC2-4482H | Recombinant Human KLHDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHDC2-4922HCL | Recombinant Human KLHDC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLHDC2 Products
Required fields are marked with *
My Review for All KLHDC2 Products
Required fields are marked with *
0
Inquiry Basket