Recombinant Full Length Human Mannose-P-Dolichol Utilization Defect 1 Protein(Mpdu1) Protein, His-Tagged
Cat.No. : | RFL34155HF |
Product Overview : | Recombinant Full Length Human Mannose-P-dolichol utilization defect 1 protein(MPDU1) Protein (O75352) (2-247aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-247) |
Form : | Lyophilized powder |
AA Sequence : | AAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQ VFKILGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLVM HYRGQTVKGVAFLACYGLVLLVLLSPLTPLTVVTLLQASNVPAVVVGRLLQAATNYHNGH TGQLSAITVFLLFGGSLARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPH KQKKAQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPDU1 |
Synonyms | MPDU1; Mannose-P-dolichol utilization defect 1 protein; Suppressor of Lec15 and Lec35 glycosylation mutation homolog; SL15 |
UniProt ID | O75352 |
◆ Recombinant Proteins | ||
RFL8499MF | Recombinant Full Length Mouse Mannose-P-Dolichol Utilization Defect 1 Protein(Mpdu1) Protein, His-Tagged | +Inquiry |
MPDU1-2811R | Recombinant Rhesus monkey MPDU1 Protein, His-tagged | +Inquiry |
MPDU1-2631R | Recombinant Rhesus Macaque MPDU1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MPDU1-677H | Recombinant Human MPDU1 | +Inquiry |
MPDU1-702C | Recombinant Cynomolgus MPDU1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPDU1-4241HCL | Recombinant Human MPDU1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPDU1 Products
Required fields are marked with *
My Review for All MPDU1 Products
Required fields are marked with *
0
Inquiry Basket