Recombinant Full Length Human MED31 Protein, GST-tagged

Cat.No. : MED31-6249HF
Product Overview : Human MED31 full-length ORF ( AAH12539, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 131 amino acids
Description : MED31 (Mediator Complex Subunit 31) is a Protein Coding gene. Among its related pathways are Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) and Gene Expression. GO annotations related to this gene include protein complex binding and RNA polymerase II transcription cofactor activity.
Molecular Mass : 40.15 kDa
AA Sequence : MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MED31 mediator complex subunit 31 [ Homo sapiens ]
Official Symbol MED31
Synonyms MED31; mediator complex subunit 31; mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 31; CGI 125; Soh1; hSOH1; mediator complex subunit SOH1; mediator of RNA polymerase II transcription, subunit 31 homolog; CGI-125; 3110004H13Rik; FLJ27436; FLJ36714;
Gene ID 51003
mRNA Refseq NM_016060
Protein Refseq NP_057144
UniProt ID Q9Y3C7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MED31 Products

Required fields are marked with *

My Review for All MED31 Products

Required fields are marked with *

0
cart-icon
0
compare icon