Recombinant Full Length Human MED31 Protein, GST-tagged
Cat.No. : | MED31-6249HF |
Product Overview : | Human MED31 full-length ORF ( AAH12539, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 131 amino acids |
Description : | MED31 (Mediator Complex Subunit 31) is a Protein Coding gene. Among its related pathways are Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) and Gene Expression. GO annotations related to this gene include protein complex binding and RNA polymerase II transcription cofactor activity. |
Molecular Mass : | 40.15 kDa |
AA Sequence : | MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MED31 mediator complex subunit 31 [ Homo sapiens ] |
Official Symbol | MED31 |
Synonyms | MED31; mediator complex subunit 31; mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 31; CGI 125; Soh1; hSOH1; mediator complex subunit SOH1; mediator of RNA polymerase II transcription, subunit 31 homolog; CGI-125; 3110004H13Rik; FLJ27436; FLJ36714; |
Gene ID | 51003 |
mRNA Refseq | NM_016060 |
Protein Refseq | NP_057144 |
UniProt ID | Q9Y3C7 |
◆ Recombinant Proteins | ||
MED31-814H | Recombinant Human MED31, GST-tagged | +Inquiry |
MED31-2587H | Recombinant Human MED31 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MED31-2726R | Recombinant Rhesus monkey MED31 Protein, His-tagged | +Inquiry |
MED31-4468H | Recombinant Human MED31 Protein, GST-tagged | +Inquiry |
Med31-4020M | Recombinant Mouse Med31 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED31-4382HCL | Recombinant Human MED31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED31 Products
Required fields are marked with *
My Review for All MED31 Products
Required fields are marked with *
0
Inquiry Basket