Recombinant Full Length Human MRPS16 Protein, C-Flag-tagged
Cat.No. : | MRPS16-958HFL |
Product Overview : | Recombinant Full Length Human MRPS16 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S16P family. The encoded protein is one of the most highly conserved ribosomal proteins between mammalian and yeast mitochondria. Three pseudogenes (located at 8q21.3, 20q13.32, 22q12-q13.1) for this gene have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 15.2 kDa |
AA Sequence : | MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNL DRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATETTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MRPS16 mitochondrial ribosomal protein S16 [ Homo sapiens (human) ] |
Official Symbol | MRPS16 |
Synonyms | S16mt; COXPD2; RPMS16; CGI-132; MRP-S16 |
Gene ID | 51021 |
mRNA Refseq | NM_016065.4 |
Protein Refseq | NP_057149.1 |
MIM | 609204 |
UniProt ID | Q9Y3D3 |
◆ Recombinant Proteins | ||
MRPS16-2675R | Recombinant Rhesus Macaque MRPS16 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS16-5714M | Recombinant Mouse MRPS16 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS16-10087M | Recombinant Mouse MRPS16 Protein | +Inquiry |
MRPS16-5309C | Recombinant Chicken MRPS16 | +Inquiry |
MRPS16-1434H | Recombinant Human MRPS16 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS16-4149HCL | Recombinant Human MRPS16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPS16 Products
Required fields are marked with *
My Review for All MRPS16 Products
Required fields are marked with *
0
Inquiry Basket