Recombinant Full Length Human NR2F1 Protein, GST-tagged
Cat.No. : | NR2F1-6740HF |
Product Overview : | Human NR2F1 full-length ORF ( NP_005645.1, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 423 amino acids |
Description : | The protein encoded by this gene is a nuclear hormone receptor and transcriptional regulator. The encoded protein acts as a homodimer and binds to 5'-AGGTCA-3' repeats. Defects in this gene are a cause of Bosch-Boonstra optic atrophy syndrome (BBOAS). [provided by RefSeq, Apr 2014] |
Molecular Mass : | 72.60 kDa |
AA Sequence : | MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NR2F1 nuclear receptor subfamily 2, group F, member 1 [ Homo sapiens ] |
Official Symbol | NR2F1 |
Synonyms | NR2F1; nuclear receptor subfamily 2, group F, member 1; ERBAL3, TFCOUP1; COUP transcription factor 1; COUP TFI; EAR 3; SVP44; TCFCOUP1; COUP-TF1; COUP-TF I; V-erbA-related protein 3; COUP transcription factor I; chicken ovalbumin upstream promoter-transcription factor I; transcription factor COUP 1 (chicken ovalbumin upstream promoter 1, v-erb-a homolog-like 3); EAR3; EAR-3; NR2F2; ERBAL3; TFCOUP1; COUP-TFI; |
Gene ID | 7025 |
mRNA Refseq | NM_005654 |
Protein Refseq | NP_005645 |
MIM | 132890 |
UniProt ID | P10589 |
◆ Recombinant Proteins | ||
Nr2f1-968M | Recombinant Mouse Nr2f1 Protein, MYC/DDK-tagged | +Inquiry |
NR2F1-1359H | Recombinant Human NR2F1, GST-tagged | +Inquiry |
NR2F1-3928H | Recombinant Human NR2F1 protein(1-423aa), His-tagged | +Inquiry |
NR2F1-1539H | Recombinant Human NR2F1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR2F1-6740HF | Recombinant Full Length Human NR2F1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR2F1-3710HCL | Recombinant Human NR2F1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR2F1 Products
Required fields are marked with *
My Review for All NR2F1 Products
Required fields are marked with *