Recombinant Full Length Human PDHA1 Protein, C-Flag-tagged
Cat.No. : | PDHA1-1646HFL |
Product Overview : | Recombinant Full Length Human PDHA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle. The PDH complex is composed of multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3). The E1 enzyme is a heterotetramer of two alpha and two beta subunits. This gene encodes the E1 alpha 1 subunit containing the E1 active site, and plays a key role in the function of the PDH complex. Mutations in this gene are associated with pyruvate dehydrogenase E1-alpha deficiency and X-linked Leigh syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.2 kDa |
AA Sequence : | MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQT VRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTG RKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNM AALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPI LMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAA QFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Butanoate metabolism, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, Metabolic pathways, Pyruvate metabolism, Valine, leucine and isoleucine biosynthesis |
Full Length : | Full L. |
Gene Name | PDHA1 pyruvate dehydrogenase E1 subunit alpha 1 [ Homo sapiens (human) ] |
Official Symbol | PDHA1 |
Synonyms | PDHA; PDHAD; PHE1A; E1alpha; PDHCE1A |
Gene ID | 5160 |
mRNA Refseq | NM_000284.4 |
Protein Refseq | NP_000275.1 |
MIM | 300502 |
UniProt ID | P08559 |
◆ Recombinant Proteins | ||
PDHA1-4465H | Recombinant Human PDHA1 protein, His&Myc-tagged | +Inquiry |
PDHA1-6598M | Recombinant Mouse PDHA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pdha1-4760M | Recombinant Mouse Pdha1 Protein, Myc/DDK-tagged | +Inquiry |
PDHA1-266H | Recombinant Human PDHA1, Gly & Pro tagged | +Inquiry |
PDHA1-3173R | Recombinant Rhesus Macaque PDHA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDHA1-001HCL | Recombinant Human PDHA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDHA1 Products
Required fields are marked with *
My Review for All PDHA1 Products
Required fields are marked with *
0
Inquiry Basket