Recombinant Full Length Human Pituitary Tumor-Transforming Gene 1 Protein-Interacting Protein(Pttg1Ip) Protein, His-Tagged
Cat.No. : | RFL32113HF |
Product Overview : | Recombinant Full Length Human Pituitary tumor-transforming gene 1 protein-interacting protein(PTTG1IP) Protein (P53801) (33-180aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (33-180) |
Form : | Lyophilized powder |
AA Sequence : | QEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTTG1IP |
Synonyms | PTTG1IP; C21orf1; C21orf3; Pituitary tumor-transforming gene 1 protein-interacting protein; Pituitary tumor-transforming gene protein-binding factor; PBF; PTTG-binding factor |
UniProt ID | P53801 |
◆ Recombinant Proteins | ||
PTTG1IP-4849R | Recombinant Rat PTTG1IP Protein | +Inquiry |
PTTG1IP-715H | Recombinant Human PTTG1IP Protein, His/GST-tagged | +Inquiry |
PTTG1IP-7297M | Recombinant Mouse PTTG1IP Protein, His (Fc)-Avi-tagged | +Inquiry |
PTTG1IP-4508R | Recombinant Rat PTTG1IP Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32113HF | Recombinant Full Length Human Pituitary Tumor-Transforming Gene 1 Protein-Interacting Protein(Pttg1Ip) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTTG1IP-1444HCL | Recombinant Human PTTG1IP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTTG1IP Products
Required fields are marked with *
My Review for All PTTG1IP Products
Required fields are marked with *
0
Inquiry Basket