Recombinant Full Length Human Probable G-Protein Coupled Receptor 37(Gpr37) Protein, His-Tagged
Cat.No. : | RFL2762HF |
Product Overview : | Recombinant Full Length Human Probable G-protein coupled receptor 37(GPR37) Protein (O15354) (27-613aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-613) |
Form : | Lyophilized powder |
AA Sequence : | ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSW DLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFL QISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAG HEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVMC LSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLLANLAFWDFLIIFFCLPLVIFHELTKK WLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVI WVGALLLALPEVVLRQLSKEDLGFSGRAPAERCIIKISPDLPDTIYVLALTYDSARLWWY FGCYFCLPTLFTITCSLVTARKIRKAEKACTRGNKRQIQLESQMNCTVVALTILYGFCII PENICNIVTAYMATGVSQQTMDLLNIISQFLLFFKSCVTPVLLFCLCKPFSRAFMECCCC CCEECIQKSSTVTSDDNDNEYTTELELSPFSTIRREMSTFASVGTHC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPR37 |
Synonyms | GPR37; Prosaposin receptor GPR37; Endothelin B receptor-like protein 1; ETBR-LP-1; G-protein coupled receptor 37; Parkin-associated endothelin receptor-like receptor; PAELR |
UniProt ID | O15354 |
◆ Recombinant Proteins | ||
RFL27263MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 37(Gpr37) Protein, His-Tagged | +Inquiry |
GPR37-542H | Recombinant Human GPR37 Protein, His-tagged | +Inquiry |
GPR37-5237H | Recombinant Human GPR37 Protein, GST-tagged | +Inquiry |
GPR37-3878M | Recombinant Mouse GPR37 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR37-1953R | Recombinant Rhesus monkey GPR37 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR37-1593HCL | Recombinant Human GPR37 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR37 Products
Required fields are marked with *
My Review for All GPR37 Products
Required fields are marked with *
0
Inquiry Basket