Recombinant Full Length Human PROKR1 Protein, C-Flag-tagged
Cat.No. : | PROKR1-1902HFL |
Product Overview : | Recombinant Full Length Human PROKR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the G-protein-coupled receptor family. The encoded protein binds to prokineticins (1 and 2), leading to the activation of MAPK and STAT signaling pathways. Prokineticins are protein ligands involved in angiogenesis and inflammation. The encoded protein is expressed in peripheral tissues such as those comprising the circulatory system, lungs, reproductive system, endocrine system and the gastrointestinal system. The protein may be involved in signaling in human fetal ovary during initiation of primordial follicle formation. Sequence variants in this gene may be associated with recurrent miscarriage. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.6 kDa |
AA Sequence : | METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFAAKIVIGMALV GIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLSWEHGHVLCTSV NYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTATGLIALVWTVSILIAIPSAYFTTETVLVIVK SQEKIFCGQIWPVDQQLYYKSYFLFIFGIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRR KTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTV KYFKKIMLLHWKASYNGGKSSADLDLKTIGMPATEEVDCIRLK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, GPCR, Transmembrane |
Full Length : | Full L. |
Gene Name | PROKR1 prokineticin receptor 1 [ Homo sapiens (human) ] |
Official Symbol | PROKR1 |
Synonyms | ZAQ; PKR1; GPR73; PK-R1; GPR73a |
Gene ID | 10887 |
mRNA Refseq | NM_138964.4 |
Protein Refseq | NP_620414.1 |
MIM | 607122 |
UniProt ID | Q8TCW9 |
◆ Recombinant Proteins | ||
PROKR1-12H | Recombinant Human PROKR1 Protein, MYC/DDK-tagged | +Inquiry |
PROKR1-13432M | Recombinant Mouse PROKR1 Protein | +Inquiry |
RFL28626HF | Recombinant Full Length Human Prokineticin Receptor 1(Prokr1) Protein, His-Tagged | +Inquiry |
PROKR1-1902HFL | Recombinant Full Length Human PROKR1 Protein, C-Flag-tagged | +Inquiry |
PROKR1-4372R | Recombinant Rat PROKR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PROKR1 Products
Required fields are marked with *
My Review for All PROKR1 Products
Required fields are marked with *
0
Inquiry Basket