Recombinant Full Length Human RAB12 Protein, C-Flag-tagged
Cat.No. : | RAB12-803HFL |
Product Overview : | Recombinant Full Length Human RAB12 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables GDP binding activity. Predicted to be involved in several processes, including cellular response to insulin stimulus; endosome to lysosome transport; and secretion by cell. Predicted to act upstream of or within cellular response to interferon-gamma. Predicted to be located in lysosome; phagocytic vesicle; and recycling endosome membrane. Predicted to be active in Golgi apparatus; cytoplasmic vesicle; and plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.1 kDa |
AA Sequence : | MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA CKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMI DKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPL DILRNELSNSILSLQPEPEIPPELPPPRPHVRCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RAB12 RAB12, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB12 |
Synonyms | FLJ45927; MGC104724 |
Gene ID | 201475 |
mRNA Refseq | NM_001025300.3 |
Protein Refseq | NP_001020471.3 |
MIM | 616448 |
UniProt ID | Q6IQ22 |
◆ Recombinant Proteins | ||
RAB12-2805Z | Recombinant Zebrafish RAB12 | +Inquiry |
RAB12-13788M | Recombinant Mouse RAB12 Protein | +Inquiry |
RAB12-3332H | Recombinant Human RAB12 protein, hFc-tagged | +Inquiry |
RAB12-4533R | Recombinant Rat RAB12 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB12-5755H | Recombinant Human RAB12 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB12 Products
Required fields are marked with *
My Review for All RAB12 Products
Required fields are marked with *