Recombinant Full Length Human Sars Coronavirus Protein 7A (7A) Protein, His-Tagged
Cat.No. : | RFL11728HF |
Product Overview : | Recombinant Full Length Human SARS coronavirus Protein 7a (7a) Protein (P59635) (16-122aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (16-122) |
Form : | Lyophilized powder |
AA Sequence : | ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | 7a |
Synonyms | 7a; ORF7a protein; Accessory protein 7a; Protein U122; Protein X4 |
UniProt ID | P59635 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All 7a Products
Required fields are marked with *
My Review for All 7a Products
Required fields are marked with *