Recombinant Full Length Human SKA2 Protein, GST-tagged
Cat.No. : | SKA2-4576HF |
Product Overview : | Human FAM33A full-length ORF (BAG51725.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 121 amino acids |
Description : | SKA2 (Spindle And Kinetochore Associated Complex Subunit 2) is a Protein Coding gene. Diseases associated with SKA2 include Post-Traumatic Stress Disorder. Among its related pathways are Mitotic Metaphase and Anaphase and Signaling by GPCR. GO annotations related to this gene include microtubule binding. |
Molecular Mass : | 40.6 kDa |
AA Sequence : | MEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVEQKESKSRICATAKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SKA2 spindle and kinetochore associated complex subunit 2 [ Homo sapiens (human) ] |
Official Symbol | SKA2 |
Synonyms | SKA2; spindle and kinetochore associated complex subunit 2; Spindle And Kinetochore Associated Complex Subunit 2; Family With Sequence Similarity 33, Member A; FAM33A; Spindle And Kinetochore-Associated Protein 2; Spindle And KT (Kinetochore) Associated 2; Protein FAM33A; spindle and kinetochore-associated protein 2; family with sequence similarity 33, member A; spindle and KT (kinetochore) associated 2 |
Gene ID | 348235 |
mRNA Refseq | NM_001100595 |
Protein Refseq | NP_001094065 |
MIM | 616674 |
UniProt ID | Q8WVK7 |
◆ Recombinant Proteins | ||
SKA2-3748H | Recombinant Human SKA2 Protein, GST-tagged | +Inquiry |
SKA2-917C | Recombinant Cynomolgus SKA2 Protein, His-tagged | +Inquiry |
SKA2-4212R | Recombinant Rhesus monkey SKA2 Protein, His-tagged | +Inquiry |
SKA2-195H | Recombinant Human SKA2 protein, T7/His-tagged | +Inquiry |
SKA2-8191M | Recombinant Mouse SKA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SKA2 Products
Required fields are marked with *
My Review for All SKA2 Products
Required fields are marked with *