Recombinant Full Length Human Zinc Transporter 10(Slc30A10) Protein, His-Tagged
Cat.No. : | RFL2675HF |
Product Overview : | Recombinant Full Length Human Zinc transporter 10(SLC30A10) Protein (Q6XR72) (1-485aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-485) |
Form : | Lyophilized powder |
AA Sequence : | MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI ARRPTRGFSATYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVG VLGLLVNVVGLLIFQDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAA DPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRG VLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAFPLIK ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQ DASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYV NRTHF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC30A10 |
Synonyms | SLC30A10; ZNT10; ZNT8; Zinc transporter 10; ZnT-10; Manganese transporter SLC30A10; Solute carrier family 30 member 10 |
UniProt ID | Q6XR72 |
◆ Recombinant Proteins | ||
SLC30A10-6743H | Recombinant Human SLC30A10 protein, His&Myc-tagged | +Inquiry |
Slc30a10-5925M | Recombinant Mouse Slc30a10 Protein, Myc/DDK-tagged | +Inquiry |
RFL6133MF | Recombinant Full Length Mouse Zinc Transporter 10(Slc30A10) Protein, His-Tagged | +Inquiry |
SLC30A10-0831H | Recombinant Human SLC30A10 Protein (G2-F485), 8×His-MBP, Flag tagged | +Inquiry |
SLC30A10-8317M | Recombinant Mouse SLC30A10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC30A10 Products
Required fields are marked with *
My Review for All SLC30A10 Products
Required fields are marked with *
0
Inquiry Basket