Recombinant Full Length Kluyveromyces Lactis Dol-P-Man:Man(5)Glcnac(2)-Pp-Dol Alpha-1,3-Mannosyltransferase(Alg3) Protein, His-Tagged
Cat.No. : | RFL7856KF |
Product Overview : | Recombinant Full Length Kluyveromyces lactis Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase(ALG3) Protein (Q6CMF1) (1-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Kluyveromyces lactis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-462) |
Form : | Lyophilized powder |
AA Sequence : | MVEEGANKTVGAPTVGDDQQPKEFVRPPFTPFQDILDAFNYLMWNPEANAIAMPVLILLE SIAMKFIQNKVSYTEIDYTAYMEQIWMIQNGERDYSQIKGGTGPLVYPAGHVFIYKIFEW VSDGLENISEAQDLFRYLYVITLMIQFMCFGLLNIPPGYAIFAILSKRLHSVYVLRLFND CFTTLFMSLAVLVMILCAKYKIRGFLVLIGSSFYSMAVSIKMNALLYLPGVLLTIYLLER CNTFKIVLNLAVMVIWQVIIAIPFWKEYPWEYLQSAFNFSRQFMYKWSVNWQMVDEEVFL DPLFHRSLLISHVIVLVVFLFYKLIPTNMNTPAGLLKIGKANLLHPFTDAVFSAMRVNAE QIAYILLVTNYIGVLFARSLHYQFLSWYHWTLPVLLNWANVPYPLCVLWYLTHEWCWNSY PPNATASTLLHACNTSLLLAVFLRGPANSKSGDNETTHEKAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALG3 |
Synonyms | ALG3; KLLA0E20823g; Dol-P-Man:Man(5GlcNAc(2-PP-Dol alpha-1,3-mannosyltransferase; Asparagine-linked glycosylation protein 6; Dol-P-Man-dependent alpha(1-3-mannosyltransferase; Dolichyl-P-Man:Man(5GlcNAc(2-PP-dolichyl mannosyltransferase |
UniProt ID | Q6CMF1 |
◆ Recombinant Proteins | ||
ALG3-464H | Recombinant Human ALG3 Protein, GST-tagged | +Inquiry |
ALG3-2857Z | Recombinant Zebrafish ALG3 | +Inquiry |
ALG3-467M | Recombinant Mouse ALG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17072PF | Recombinant Full Length Phaeosphaeria Nodorum Dol-P-Man:Man(5)Glcnac(2)-Pp-Dol Alpha-1,3-Mannosyltransferase(Alg3) Protein, His-Tagged | +Inquiry |
ALG3-1547M | Recombinant Mouse ALG3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALG3 Products
Required fields are marked with *
My Review for All ALG3 Products
Required fields are marked with *