Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Rnf185(Rnf185) Protein, His-Tagged
Cat.No. : | RFL36829MF |
Product Overview : | Recombinant Full Length Mouse E3 ubiquitin-protein ligase RNF185(Rnf185) Protein (Q91YT2) (1-192aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-192) |
Form : | Lyophilized powder |
AA Sequence : | MASKGPSASASTENSNAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFCW PCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENR GGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLF VALVIMFWLLIA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rnf185 |
Synonyms | Rnf185; E3 ubiquitin-protein ligase RNF185; RING finger protein 185; RING-type E3 ubiquitin transferase RNF185 |
UniProt ID | Q91YT2 |
◆ Recombinant Proteins | ||
RNF185-12275Z | Recombinant Zebrafish RNF185 | +Inquiry |
RNF185-1765C | Recombinant Chicken RNF185 | +Inquiry |
RFL25823PF | Recombinant Full Length Pongo Abelii E3 Ubiquitin-Protein Ligase Rnf185(Rnf185) Protein, His-Tagged | +Inquiry |
RNF185-676H | Recombinant Human RNF185 Protein, MYC/DDK-tagged | +Inquiry |
RNF185-7669M | Recombinant Mouse RNF185 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF185-1523HCL | Recombinant Human RNF185 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rnf185 Products
Required fields are marked with *
My Review for All Rnf185 Products
Required fields are marked with *