Recombinant Full Length Pongo Abelii Transmembrane Protein 174(Tmem174) Protein, His-Tagged
Cat.No. : | RFL16828PF |
Product Overview : | Recombinant Full Length Pongo abelii Transmembrane protein 174(TMEM174) Protein (Q5R8E0) (1-243aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-243) |
Form : | Lyophilized powder |
AA Sequence : | MEQGSGRLEDFPVNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWI KYQGVSHFEWTQLLGPVLLSVGVTFILIAVCKFKMLSCQLCKESEERVLDSEQTPGGPSF VFTGINQPITFHGATVVQYIPPPYGSPEPVGINTSYLQSVVSPCSLITSGGAAAAMSSPS QYYTIYPQDNSAFVVDEGCPSFADGGNHRPNPDADQLEETQLEEEACACFSPPPYEEIYS LPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM174 |
Synonyms | TMEM174; Transmembrane protein 174 |
UniProt ID | Q5R8E0 |
◆ Recombinant Proteins | ||
RFL7460HF | Recombinant Full Length Human Transmembrane Protein 174(Tmem174) Protein, His-Tagged | +Inquiry |
TMEM174-5445C | Recombinant Chicken TMEM174 | +Inquiry |
TMEM174-4785R | Recombinant Rhesus monkey TMEM174 Protein, His-tagged | +Inquiry |
TMEM174-16952M | Recombinant Mouse TMEM174 Protein | +Inquiry |
RFL16828PF | Recombinant Full Length Pongo Abelii Transmembrane Protein 174(Tmem174) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM174-987HCL | Recombinant Human TMEM174 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM174 Products
Required fields are marked with *
My Review for All TMEM174 Products
Required fields are marked with *
0
Inquiry Basket