Recombinant Full Length Rat Gap Junction Beta-3 Protein(Gjb3) Protein, His-Tagged
Cat.No. : | RFL4261RF |
Product Overview : | Recombinant Full Length Rat Gap junction beta-3 protein(Gjb3) Protein (P25305) (1-270aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-270) |
Form : | Lyophilized powder |
AA Sequence : | MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTRQPGC TNVCYDNFFPISNIRLWALQLIFVTCPSMLVILHVAYREERERKHRQKHGEHCAKLYSHP GKKHGGLWWTYLFSLIFKLIIELVFLYVLHTLWHGFTMPRLVQCASVVPCPNTVDCYIAR PTEKKVFTYFMVGASAVCIILTICEICYLIFHRIMRGLSKDKSTKSISSPKSSSRASTCR CHHKLLESGDLEAVPADDKLQASAPSLTPI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gjb3 |
Synonyms | Gjb3; Cxn-31; Gap junction beta-3 protein; Connexin-31; Cx31 |
UniProt ID | P25305 |
◆ Recombinant Proteins | ||
RFL4261RF | Recombinant Full Length Rat Gap Junction Beta-3 Protein(Gjb3) Protein, His-Tagged | +Inquiry |
GJB3-5295HF | Recombinant Full Length Human GJB3 Protein, GST-tagged | +Inquiry |
GJB3-13278H | Recombinant Human GJB3, His-tagged | +Inquiry |
Gjb3-7000R | Recombinant Rat Gjb3 protein, His & GST-tagged | +Inquiry |
Gjb3-3218M | Recombinant Mouse Gjb3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJB3-5918HCL | Recombinant Human GJB3 293 Cell Lysate | +Inquiry |
GJB3-5919HCL | Recombinant Human GJB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gjb3 Products
Required fields are marked with *
My Review for All Gjb3 Products
Required fields are marked with *
0
Inquiry Basket