Recombinant Full Length Rat Mitochondrial Glutamate Carrier 2(Slc25A18) Protein, His-Tagged
Cat.No. : | RFL30924RF |
Product Overview : | Recombinant Full Length Rat Mitochondrial glutamate carrier 2(Slc25a18) Protein (Q505J6) (1-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-320) |
Form : | Lyophilized powder |
AA Sequence : | MIACRMSSQDLSITAKLINGGIAGLVGVTCVFPIDLAKTRLQNQQGKDVYKGMTDCLVKT ARAEGFLGMYRGAAVNLTLVTPEKAIKLAANDFLRQLLMQDGTQRNLKMEMLAGCGAGIC QVVITCPMEMLKIQLQDAGRLAVCQQASASATPTSRPYSTGSTSTHRRPSATLIAWELLR TQGLSGLYRGLGATLLRDIPFSIIYFPLFANLNQLGVSELTGKASFTHSFVAGCAAGSVS AVAVTPLDVLKTRIQTLKKGLGEDTYRGVTDCARKLWTQEGAAAFMKGAGCRALVIAPLF GIAQGVYFIGIGERILKCFE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc25a18 |
Synonyms | Slc25a18; Mitochondrial glutamate carrier 2; GC-2; Glutamate/H(+ symporter 2; Solute carrier family 25 member 18 |
UniProt ID | Q505J6 |
◆ Recombinant Proteins | ||
Slc25a18-1021R | Recombinant Rat Slc25a18 Full Length Transmembrane protein, His-tagged | +Inquiry |
SLC25A18-5129R | Recombinant Rat SLC25A18 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A18-338H | Recombinant Human Solute Carrier Family 25 (mitochondrial carrier), Member 18 | +Inquiry |
Slc25a18-0184M | Recombinant Mouse Slc25a18 Full Length Transmembrane protein, His-tagged | +Inquiry |
SLC25A18-5470R | Recombinant Rat SLC25A18 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A18-1779HCL | Recombinant Human SLC25A18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc25a18 Products
Required fields are marked with *
My Review for All Slc25a18 Products
Required fields are marked with *