Recombinant Human AASDHPPT protein, GST-tagged
Cat.No. : | AASDHPPT-9200H |
Product Overview : | Recombinant Human AASDHPPT protein(1-309 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-309 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS |
Gene Name | AASDHPPT aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase [ Homo sapiens ] |
Official Symbol | AASDHPPT |
Synonyms | AASDHPPT; aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; AASD PPT; CGI 80; LYS5; LYS5 ortholog; 4-phosphopantetheinyl transferase; alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase; LYS2; CGI-80; AASD-PPT; |
Gene ID | 60496 |
mRNA Refseq | NM_015423 |
Protein Refseq | NP_056238 |
MIM | 607756 |
UniProt ID | Q9NRN7 |
◆ Recombinant Proteins | ||
AASDHPPT-760HF | Recombinant Full Length Human AASDHPPT Protein, GST-tagged | +Inquiry |
AASDHPPT-1479H | Recombinant Human AASDHPPT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AASDHPPT-4803H | Recombinant Human AASDHPPT protein, His-SUMO-tagged | +Inquiry |
AASDHPPT-1067M | Recombinant Mouse AASDHPPT Protein | +Inquiry |
AASDHPPT-44R | Recombinant Rat AASDHPPT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AASDHPPT-2HCL | Recombinant Human AASDHPPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AASDHPPT Products
Required fields are marked with *
My Review for All AASDHPPT Products
Required fields are marked with *