Recombinant Human ABCA9 protein, His-tagged
Cat.No. : | ABCA9-7645H |
Product Overview : | Recombinant Human ABCA9 protein(52-183 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 52-183 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | HQVHDTPQMSSMDLGRVDSFNDTNYVIAFAPESKTTQEIMNKVASAPFLKGRTIMGWPDEKSMDELDLNYSIDAVRVIFTDTFSYHLKFSWGHRIPMMKEHRDHSAHCQAVNEKMKCEGSEFWEKGFVAFQA |
Gene Name | ABCA9 ATP-binding cassette, sub-family A (ABC1), member 9 [ Homo sapiens ] |
Official Symbol | ABCA9 |
Synonyms | ABCA9; ATP-binding cassette, sub-family A (ABC1), member 9; ATP-binding cassette sub-family A member 9; EST640918; ATP-binding cassette A9; MGC75415; DKFZp686F2450; |
Gene ID | 10350 |
mRNA Refseq | NM_080283 |
Protein Refseq | NP_525022 |
MIM | 612507 |
UniProt ID | Q8IUA7 |
◆ Recombinant Proteins | ||
ABCA9-7644H | Recombinant Human ABCA9 protein, GST-tagged | +Inquiry |
Abca9-8145M | Recombinant Mouse Abca9 protein, His & T7-tagged | +Inquiry |
ABCA9-8144H | Recombinant Human ABCA9 protein, His & T7-tagged | +Inquiry |
ABCA9-185M | Recombinant Mouse ABCA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Abca9-8146R | Recombinant Rat Abca9 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCA9 Products
Required fields are marked with *
My Review for All ABCA9 Products
Required fields are marked with *