Recombinant Human ABCE1 protein, His-tagged
| Cat.No. : | ABCE1-3392H |
| Product Overview : | Recombinant Human ABCE1 protein(76-256 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 76-256 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | PSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ABCE1 ATP-binding cassette, sub-family E (OABP), member 1 [ Homo sapiens ] |
| Official Symbol | ABCE1 |
| Synonyms | RLI; OABP; ABC38; RNS4I; RNASEL1; RNASELI |
| Gene ID | 6059 |
| mRNA Refseq | NM_002940.2 |
| Protein Refseq | NP_002931.2 |
| MIM | 601213 |
| UniProt ID | P61221 |
| ◆ Recombinant Proteins | ||
| ABCE1-1580C | Recombinant Chicken ABCE1 | +Inquiry |
| ABCE1-5317H | Recombinant Human ABCE1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ABCE1-0260H | Recombinant Human ABCE1 Protein (Ile389-Asn556), N-His-tagged | +Inquiry |
| ABCE1-8116H | Recombinant Human ABCE1 protein, His & T7-tagged | +Inquiry |
| ABCE1-204M | Recombinant Mouse ABCE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABCE1-9145HCL | Recombinant Human ABCE1 293 Cell Lysate | +Inquiry |
| ABCE1-319HKCL | Human ABCE1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCE1 Products
Required fields are marked with *
My Review for All ABCE1 Products
Required fields are marked with *
