Recombinant Human ABRACL Protein, GST-Tagged
Cat.No. : | ABRACL-0103H |
Product Overview : | Human ABRACL full-length ORF (AAH14953, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ABRACL (ABRA C-Terminal Like) is a Protein Coding gene. |
Molecular Mass : | 34.65 kDa |
AA Sequence : | MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABRACL ABRA C-terminal like [ Homo sapiens (human) ] |
Official Symbol | ABRACL |
Synonyms | ABRACL; ABRA C-terminal like; C6ORF115; chromosome 6 open reading frame 115; C6orf115, chromosome 6 open reading frame 115; Costars; HSPC280; PRO2013; costars family protein ABRACL; ABRA C-terminal-like protein |
Gene ID | 58527 |
mRNA Refseq | NM_021243 |
Protein Refseq | NP_067066 |
UniProt ID | Q9P1F3 |
◆ Recombinant Proteins | ||
ABRACL-0103H | Recombinant Human ABRACL Protein, GST-Tagged | +Inquiry |
ABRACL-588H | Recombinant Human ABRA C-terminal like, His-tagged | +Inquiry |
ABRACL-24R | Recombinant Rhesus Macaque ABRACL Protein, His (Fc)-Avi-tagged | +Inquiry |
ABRACL-2683HF | Recombinant Full Length Human ABRACL Protein, GST-tagged | +Inquiry |
ABRACL-671H | Recombinant Human ABRACL Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABRACL Products
Required fields are marked with *
My Review for All ABRACL Products
Required fields are marked with *