Recombinant Human ABRACL Protein, GST-Tagged

Cat.No. : ABRACL-0103H
Product Overview : Human ABRACL full-length ORF (AAH14953, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ABRACL (ABRA C-Terminal Like) is a Protein Coding gene.
Molecular Mass : 34.65 kDa
AA Sequence : MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABRACL ABRA C-terminal like [ Homo sapiens (human) ]
Official Symbol ABRACL
Synonyms ABRACL; ABRA C-terminal like; C6ORF115; chromosome 6 open reading frame 115; C6orf115, chromosome 6 open reading frame 115; Costars; HSPC280; PRO2013; costars family protein ABRACL; ABRA C-terminal-like protein
Gene ID 58527
mRNA Refseq NM_021243
Protein Refseq NP_067066
UniProt ID Q9P1F3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABRACL Products

Required fields are marked with *

My Review for All ABRACL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon