Recombinant Human ACAA1 Protein, GST-Tagged

Cat.No. : ACAA1-122H
Product Overview : Human ACAA1 full-length ORF ( NP_001598.1, 1 a.a. - 424 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Molecular Mass : 70.7 kDa
AA Sequence : MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACAA1 acetyl-CoA acyltransferase 1 [ Homo sapiens ]
Official Symbol ACAA1
Synonyms ACAA1; acetyl-CoA acyltransferase 1; acetyl Coenzyme A acyltransferase 1; 3-ketoacyl-CoA thiolase, peroxisomal; peroxisomal 3 oxoacyl Coenzyme A thiolase; beta-ketothiolase; peroxisomal 3-oxoacyl-CoA thiolase; acetyl-Coenzyme A acyltransferase 1; peroxisomal 3-oxoacyl-Coenzyme A thiolase; ACAA; THIO; PTHIO;
Gene ID 30
mRNA Refseq NM_001130410
Protein Refseq NP_001123882
MIM 604054
UniProt ID P09110

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACAA1 Products

Required fields are marked with *

My Review for All ACAA1 Products

Required fields are marked with *

0
cart-icon