"ACPP" Related Products

Expand
Expand

Recombinant Human ACPP protein, Arginine-tagged

Cat.No.: ACPP-150H
Product Overview: Recombinant human ACPP protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: KELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHEQVYIRST DVDRTLMSAMTNLAALVPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKRLH PYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNFTLPSRATEDTMTKLRELSELSLLSLYGIHKQKEKSR LQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELYFEKGEYFVEMYYR NETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Human prostate specific tumor antigen.2. Immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: ACPP acid phosphatase, prostate [ Homo sapiens ]
Official Symbol: ACPP
Synonyms: ACPP; acid phosphatase, prostate; prostatic acid phosphatase; ACP 3; ACP3; TMPase; 5-nucleotidase; ecto-5-nucleotidase; thiamine monophosphatase; PAP; 5-NT; ACP-3;
Gene ID: 55
mRNA Refseq: NM_001099
Protein Refseq: NP_001090
MIM: 171790
UniProt ID: P15309
Chromosome Location: 3q21-qter
Pathway: Riboflavin metabolism, organism-specific biosystem; Riboflavin metabolism, conserved biosystem;
Function: 5-nucleotidase activity; acid phosphatase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.