Recombinant Human ACPP protein, Arginine-tagged
Cat.No. : | ACPP-150H |
Product Overview : | Recombinant human ACPP protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | KELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHEQVYIRST DVDRTLMSAMTNLAALVPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKRLH PYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNFTLPSRATEDTMTKLRELSELSLLSLYGIHKQKEKSR LQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELYFEKGEYFVEMYYR NETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQLEESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Human prostate specific tumor antigen.2. Immunogen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | ACPP acid phosphatase, prostate [ Homo sapiens ] |
Official Symbol | ACPP |
Synonyms | ACPP; acid phosphatase, prostate; prostatic acid phosphatase; ACP 3; ACP3; TMPase; 5-nucleotidase; ecto-5-nucleotidase; thiamine monophosphatase; PAP; 5-NT; ACP-3; |
Gene ID | 55 |
mRNA Refseq | NM_001099 |
Protein Refseq | NP_001090 |
MIM | 171790 |
UniProt ID | P15309 |
Chromosome Location | 3q21-qter |
Pathway | Riboflavin metabolism, organism-specific biosystem; Riboflavin metabolism, conserved biosystem; |
Function | 5-nucleotidase activity; acid phosphatase activity; hydrolase activity; |
◆ Recombinant Proteins | ||
acpP-5477S | Recombinant Staph acpP protein, His-tagged | +Inquiry |
ACPP-184H | Recombinant Human ACPP Protein, GST-Tagged | +Inquiry |
ACPP-463R | Recombinant Rat ACPP Protein | +Inquiry |
ACPP-680S | Recombinant Staphylococcus Aureus ACPP Protein (1-77 aa), GST-tagged | +Inquiry |
ACPP-9311H | Recombinant Human ACPP, His-tagged | +Inquiry |
◆ Native Proteins | ||
ACPP-8250H | Native Human Prostatic Acid Phosphatase | +Inquiry |
ACPP-29981TH | Native Human ACPP | +Inquiry |
ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
PAP-01H | Active Native Human PAP | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACPP-1880HCL | Recombinant Human ACPP cell lysate | +Inquiry |
ACPP-1625MCL | Recombinant Mouse ACPP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACPP Products
Required fields are marked with *
My Review for All ACPP Products
Required fields are marked with *