"ACTR1B" Related Products

Expand

Recombinant Human ACTR1B Protein, GST-tagged

Cat.No. : ACTR1B-234H
Product Overview : Human ACTR1B full-length ORF ( NP_005726.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex. [provided by RefSeq, Aug 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 68.7 kDa
AA Sequence : MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVLSGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : ACTR1B ARP1 actin-related protein 1 homolog B, centractin beta (yeast) [ Homo sapiens ]
Official Symbol : ACTR1B
Synonyms : ACTR1B; ARP1 actin-related protein 1 homolog B, centractin beta (yeast); ARP1 (actin related protein 1, yeast) homolog B (centractin beta) , CTRN2; beta-centractin; centractin beta; actin-related protein 1B; PC3; ARP1B; CTRN2;
Gene ID : 10120
mRNA Refseq : NM_005735
Protein Refseq : NP_005726
MIM : 605144
UniProt ID : P42025

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.