Recombinant Human AK3 Protein, GST-tagged
Cat.No. : | AK3-486H |
Product Overview : | Human AK3 full-length ORF ( NP_057366.2, 1 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 52 kDa |
AA Sequence : | MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AK3 adenylate kinase 3 [ Homo sapiens ] |
Official Symbol | AK3 |
Synonyms | AK3; adenylate kinase 3; adenylate kinase 3 like 1, adenylate kinase 6, AK3L1, AK6; GTP:AMP phosphotransferase, mitochondrial; AKL3L1; adenylate kinase 3 alpha-like 1; adenylate kinase 6, adenylate kinase 3 like 1; AK6; FIX; AK3L1; AKL3L; |
Gene ID | 50808 |
mRNA Refseq | NM_001199852 |
Protein Refseq | NP_001186781 |
MIM | 609290 |
UniProt ID | Q9UIJ7 |
◆ Recombinant Proteins | ||
AK3-301589H | Recombinant Human AK3 protein, GST-tagged | +Inquiry |
AK3-12348Z | Recombinant Zebrafish AK3 | +Inquiry |
AK3-1464M | Recombinant Mouse AK3 Protein | +Inquiry |
AK3-422M | Recombinant Mouse AK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AK3-240R | Recombinant Rat AK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AK3-8947HCL | Recombinant Human AK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AK3 Products
Required fields are marked with *
My Review for All AK3 Products
Required fields are marked with *