Recombinant Human AKAP7
| Cat.No. : | AKAP7-26524TH |
| Product Overview : | Recombinant full length Human AKAP7 produced in Saccharomyces cerevisiae; amino acids 1-81; 81 amino acids, 8.9kDa. Protein has a 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Protein Length : | 1-81 a.a. |
| Description : | This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. |
| Tissue specificity : | Expressed in brain, heart, lung, pancreas and skeletal muscle. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENA VLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNEN NRK |
| Full Length : | Full L. |
| Gene Name | AKAP7 A kinase (PRKA) anchor protein 7 [ Homo sapiens ] |
| Official Symbol | AKAP7 |
| Synonyms | AKAP7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 7 isoform gamma; AKAP15; AKAP18; |
| Gene ID | 9465 |
| mRNA Refseq | NM_004842 |
| Protein Refseq | NP_004833 |
| MIM | 604693 |
| Uniprot ID | O43687 |
| Chromosome Location | 6q22-q24 |
| Pathway | G Protein Signaling Pathways, organism-specific biosystem; |
| Function | AMP binding; catalytic activity; protein C-terminus binding; protein complex scaffold; protein domain specific binding; |
| ◆ Recombinant Proteins | ||
| AKAP7-249R | Recombinant Rat AKAP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AKAP7-2395H | Recombinant Human A-kinase (PRKA) Anchor Protein 7, His-tagged | +Inquiry |
| Akap7-3031M | Recombinant Mouse Akap7, GST-tagged | +Inquiry |
| Akap7-1578M | Recombinant Mouse Akap7 Protein, Myc/DDK-tagged | +Inquiry |
| AKAP7-1068H | Recombinant Human AKAP7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AKAP7-8938HCL | Recombinant Human AKAP7 293 Cell Lysate | +Inquiry |
| AKAP7-8937HCL | Recombinant Human AKAP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKAP7 Products
Required fields are marked with *
My Review for All AKAP7 Products
Required fields are marked with *
