Recombinant Human AKIRIN2 protein, GST-tagged
Cat.No. : | AKIRIN2-3643H |
Product Overview : | Recombinant Human AKIRIN2 protein(1-203 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-203 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS |
Gene Name | AKIRIN2 akirin 2 [ Homo sapiens ] |
Official Symbol | AKIRIN2 |
Synonyms | AKIRIN2; akirin 2; C6orf166, chromosome 6 open reading frame 166; akirin-2; dJ486L4.2; FLJ10342; fourteen-three-three beta interactant 1; FBI1; C6orf166; |
Gene ID | 55122 |
mRNA Refseq | NM_018064 |
Protein Refseq | NP_060534 |
UniProt ID | Q53H80 |
◆ Recombinant Proteins | ||
AKIRIN2-12482Z | Recombinant Zebrafish AKIRIN2 | +Inquiry |
AKIRIN2-2584HF | Recombinant Full Length Human AKIRIN2 Protein, GST-tagged | +Inquiry |
AKIRIN2-594R | Recombinant Rat AKIRIN2 Protein | +Inquiry |
AKIRIN2-4119C | Recombinant Chicken AKIRIN2 | +Inquiry |
AKIRIN2-3244B | Recombinant Bovine AKIRIN2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKIRIN2-8934HCL | Recombinant Human AKIRIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKIRIN2 Products
Required fields are marked with *
My Review for All AKIRIN2 Products
Required fields are marked with *