"AMD1" Related Products

Expand
Expand
Expand

Recombinant Human AMD1 protein, T7-tagged

Cat.No.: AMD1-122H
Product Overview: Recombinant human AMD1 fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFGSEAAHFFEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDK QEAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKPSHQGYPHRNFQEEI EFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGI RDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTL FVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro human polyamine biosynthesis regulation study.2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used as cancer biomarker for diagnosis application development.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: AMD1 adenosylmethionine decarboxylase 1 [ Homo sapiens ]
Official Symbol: AMD1
Synonyms: AMD1; adenosylmethionine decarboxylase 1; S adenosylmethionine decarboxylase 1; S-adenosylmethionine decarboxylase proenzyme; SAMDC; S-adenosylmethionine decarboxylase 1; AMD; ADOMETDC; FLJ26964; DKFZp313L1234;
Gene ID: 262
mRNA Refseq: NM_001033059
Protein Refseq: NP_001028231
MIM: 180980
UniProt ID: P17707
Chromosome Location: 6q21
Pathway: Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem;
Function: adenosylmethionine decarboxylase activity; adenosylmethionine decarboxylase activity; lyase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.