Recombinant Human AMD1 protein, T7-tagged
Cat.No. : | AMD1-122H |
Product Overview : | Recombinant human AMD1 fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFGSEAAHFFEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDK QEAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKPSHQGYPHRNFQEEI EFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGI RDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTL FVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human polyamine biosynthesis regulation study.2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used as cancer biomarker for diagnosis application development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | AMD1 adenosylmethionine decarboxylase 1 [ Homo sapiens ] |
Official Symbol | AMD1 |
Synonyms | AMD1; adenosylmethionine decarboxylase 1; S adenosylmethionine decarboxylase 1; S-adenosylmethionine decarboxylase proenzyme; SAMDC; S-adenosylmethionine decarboxylase 1; AMD; ADOMETDC; FLJ26964; DKFZp313L1234; |
Gene ID | 262 |
mRNA Refseq | NM_001033059 |
Protein Refseq | NP_001028231 |
MIM | 180980 |
UniProt ID | P17707 |
Chromosome Location | 6q21 |
Pathway | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; |
Function | adenosylmethionine decarboxylase activity; adenosylmethionine decarboxylase activity; lyase activity; |
◆ Recombinant Proteins | ||
AMD1-647R | Recombinant Rat AMD1 Protein | +Inquiry |
AMD1-516H | Recombinant Human AMD1 protein, GST-tagged | +Inquiry |
AMD1-130H | Recombinant Human AMD1 Protein, His-tagged | +Inquiry |
Amd1-591M | Recombinant Mouse Amd1 Protein, MYC/DDK-tagged | +Inquiry |
AMD1-619H | Recombinant Human AMD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMD1-8886HCL | Recombinant Human AMD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMD1 Products
Required fields are marked with *
My Review for All AMD1 Products
Required fields are marked with *