Recombinant Human AMD1 protein, T7-tagged

Cat.No. : AMD1-122H
Product Overview : Recombinant human AMD1 fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFGSEAAHFFEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDK QEAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKPSHQGYPHRNFQEEI EFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGI RDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTL FVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human polyamine biosynthesis regulation study.2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used as cancer biomarker for diagnosis application development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name AMD1 adenosylmethionine decarboxylase 1 [ Homo sapiens ]
Official Symbol AMD1
Synonyms AMD1; adenosylmethionine decarboxylase 1; S adenosylmethionine decarboxylase 1; S-adenosylmethionine decarboxylase proenzyme; SAMDC; S-adenosylmethionine decarboxylase 1; AMD; ADOMETDC; FLJ26964; DKFZp313L1234;
Gene ID 262
mRNA Refseq NM_001033059
Protein Refseq NP_001028231
MIM 180980
UniProt ID P17707
Chromosome Location 6q21
Pathway Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem;
Function adenosylmethionine decarboxylase activity; adenosylmethionine decarboxylase activity; lyase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AMD1 Products

Required fields are marked with *

My Review for All AMD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon