Recombinant Human AMT protein, GST-tagged
Cat.No. : | AMT-531H |
Product Overview : | Human AMT full-length ORF ( AAH07546, 1 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes one of four critical components of the glycine cleavage system. Mutations in this gene have been associated with glycine encephalopathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
Molecular Mass : | 57.53 kDa |
AA Sequence : | MESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVELPSGPCF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AMT aminomethyltransferase [ Homo sapiens ] |
Official Symbol | AMT |
Synonyms | AMT; aminomethyltransferase; aminomethyltransferase (glycine cleavage system protein T); aminomethyltransferase, mitochondrial; GCST; glycine cleavage system protein T; NKH; glycine cleavage system T protein; GCE; GCVT; |
Gene ID | 275 |
mRNA Refseq | NM_000481 |
Protein Refseq | NP_000472 |
MIM | 238310 |
UniProt ID | P48728 |
◆ Recombinant Proteins | ||
AMT-531H | Recombinant Human AMT protein, GST-tagged | +Inquiry |
AMT-3425H | Recombinant Human AMT, His-tagged | +Inquiry |
AMT-144R | Recombinant Rhesus Macaque AMT Protein, His (Fc)-Avi-tagged | +Inquiry |
AMT-316R | Recombinant Rhesus monkey AMT Protein, His-tagged | +Inquiry |
AMT-6744H | Recombinant Human AMT protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMT-72HCL | Recombinant Human AMT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMT Products
Required fields are marked with *
My Review for All AMT Products
Required fields are marked with *
0
Inquiry Basket