Recombinant Human ARF3 protein, GST-tagged
Cat.No. : | ARF3-745H |
Product Overview : | Human ARF3 full-length ORF ( AAH07762, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 45.65 kDa |
AA Sequence : | MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARF3 ADP-ribosylation factor 3 [ Homo sapiens ] |
Official Symbol | ARF3 |
Synonyms | ARF3; ADP-ribosylation factor 3; small GTP binding protein; |
Gene ID | 377 |
mRNA Refseq | NM_001659 |
Protein Refseq | NP_001650 |
MIM | 103190 |
UniProt ID | P61204 |
◆ Recombinant Proteins | ||
ARF3-1839M | Recombinant Mouse ARF3 Protein | +Inquiry |
ARF3-4840H | Recombinant Human ARF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARF3-6867H | Recombinant Human ADP-Ribosylation Factor 3, His-tagged | +Inquiry |
ARF3-237H | Recombinant Human ARF3 protein(Met1-Lys181), His-tagged | +Inquiry |
ARF3-9800H | Recombinant Human ARF3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARF3-8759HCL | Recombinant Human ARF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARF3 Products
Required fields are marked with *
My Review for All ARF3 Products
Required fields are marked with *
0
Inquiry Basket