Recombinant Human ARFIP1 protein, GST-tagged
| Cat.No. : | ARFIP1-1815H | 
| Product Overview : | Recombinant Human ARFIP1 protein(1-373 aa), fused to GST tag, was expressed in E. coli. | 
| Availability | November 04, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 1-373 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. | 
| AA Sequence : | MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWLEEQ | 
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.  | 
                                
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.  | 
                                
| Gene Name | ARFIP1 ADP-ribosylation factor interacting protein 1 [ Homo sapiens ] | 
| Official Symbol | ARFIP1 | 
| Synonyms | ARFIP1; ADP-ribosylation factor interacting protein 1; arfaptin-1; arfaptin 1; HSU52521; ADP-ribosylation factor-interacting protein 1; MGC117369; | 
| Gene ID | 27236 | 
| mRNA Refseq | NM_001025593 | 
| Protein Refseq | NP_001020764 | 
| MIM | 605928 | 
| UniProt ID | P53367 | 
| ◆ Recombinant Proteins | ||
| ARFIP1-753H | Recombinant Human ARFIP1 protein, GST-tagged | +Inquiry | 
| ARFIP1-1225HF | Recombinant Full Length Human ARFIP1 Protein, GST-tagged | +Inquiry | 
| ARFIP1-413R | Recombinant Rat ARFIP1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ARFIP1-213R | Recombinant Rhesus Macaque ARFIP1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ARFIP1-3619H | Recombinant Human ARFIP1, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ARFIP1-8750HCL | Recombinant Human ARFIP1 293 Cell Lysate | +Inquiry | 
| ARFIP1-8752HCL | Recombinant Human ARFIP1 293 Cell Lysate | +Inquiry | 
| ARFIP1-8751HCL | Recombinant Human ARFIP1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ARFIP1 Products
Required fields are marked with *
My Review for All ARFIP1 Products
Required fields are marked with *
  
        
    
      
            