Recombinant Human ARL4A protein, T7-tagged
| Cat.No. : | ARL4A-193H |
| Product Overview : | Recombinant human ARL4A (200 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 200 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGEFMGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIK VTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANK QDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | ARL4A ADP-ribosylation factor-like 4A [ Homo sapiens ] |
| Official Symbol | ARL4A |
| Synonyms | ARL4A; ADP-ribosylation factor-like 4A; ADP ribosylation factor like 4 , ARL4; ADP-ribosylation factor-like protein 4A; ADP-ribosylation factor-like 4; ARL4; |
| Gene ID | 10124 |
| mRNA Refseq | NM_001037164 |
| Protein Refseq | NP_001032241 |
| MIM | 604786 |
| UniProt ID | P40617 |
| Chromosome Location | 7p21.3 |
| Function | GTP binding; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| ARL4A-783R | Recombinant Rat ARL4A Protein | +Inquiry |
| ARL4A-230R | Recombinant Rhesus Macaque ARL4A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARL4A-401R | Recombinant Rhesus monkey ARL4A Protein, His-tagged | +Inquiry |
| ARL4A-439R | Recombinant Rat ARL4A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARL4A-722M | Recombinant Mouse ARL4A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL4A-8713HCL | Recombinant Human ARL4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL4A Products
Required fields are marked with *
My Review for All ARL4A Products
Required fields are marked with *



