Recombinant Human ARL4A protein, T7-tagged
Cat.No. : | ARL4A-193H |
Product Overview : | Recombinant human ARL4A (200 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 200 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIK VTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANK QDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | ARL4A ADP-ribosylation factor-like 4A [ Homo sapiens ] |
Official Symbol | ARL4A |
Synonyms | ARL4A; ADP-ribosylation factor-like 4A; ADP ribosylation factor like 4 , ARL4; ADP-ribosylation factor-like protein 4A; ADP-ribosylation factor-like 4; ARL4; |
Gene ID | 10124 |
mRNA Refseq | NM_001037164 |
Protein Refseq | NP_001032241 |
MIM | 604786 |
UniProt ID | P40617 |
Chromosome Location | 7p21.3 |
Function | GTP binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
ARL4A-3602H | Recombinant Human ARL4A, His-tagged | +Inquiry |
ARL4A-722M | Recombinant Mouse ARL4A Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL4A-401R | Recombinant Rhesus monkey ARL4A Protein, His-tagged | +Inquiry |
ARL4A-2550H | Recombinant Human ARL4A protein, His-tagged | +Inquiry |
ARL4A-3026H | Recombinant Human ADP-Ribosylation Factor-Like 4A, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL4A-8713HCL | Recombinant Human ARL4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL4A Products
Required fields are marked with *
My Review for All ARL4A Products
Required fields are marked with *