Recombinant Human ARPC4 protein, GST-tagged

Cat.No. : ARPC4-848H
Product Overview : Human ARPC4 full-length ORF ( NP_001020130.1, 1 a.a. - 78 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of seven subunits of the human Arp2/3 protein complex. This complex controls actin polymerization in cells and has been conserved throughout eukaryotic evolution. This gene encodes the p20 subunit, which is necessary for actin nucleation and high-affinity binding to F-actin. Alternative splicing results in multiple transcript variants. Naturally occurring read-through transcription exists between this gene and the downstream tubulin tyrosine ligase-like family, member 3 (TTLL3), which results in the production of a fusion protein. [provided by RefSeq, Nov 2010]
Molecular Mass : 36 kDa
AA Sequence : MRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARPC4 actin related protein 2/3 complex, subunit 4, 20kDa [ Homo sapiens ]
Official Symbol ARPC4
Synonyms ARPC4; actin related protein 2/3 complex, subunit 4, 20kDa; actin related protein 2/3 complex, subunit 4 (20 kD); actin-related protein 2/3 complex subunit 4; actin related protein 2/3 complex; subunit 4 (20 kD); ARC20; Arp2/3 protein complex subunit p20; p20 Arc; arp2/3 complex 20 kDa subunit; arp2/3 protein complex subunit p20; P20-ARC; MGC13544;
Gene ID 10093
mRNA Refseq NM_001024959
Protein Refseq NP_001020130
MIM 604226
UniProt ID P59998

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARPC4 Products

Required fields are marked with *

My Review for All ARPC4 Products

Required fields are marked with *

0
cart-icon
0
compare icon