Recombinant Human ARPC4 protein, GST-tagged
Cat.No. : | ARPC4-848H |
Product Overview : | Human ARPC4 full-length ORF ( NP_001020130.1, 1 a.a. - 78 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes one of seven subunits of the human Arp2/3 protein complex. This complex controls actin polymerization in cells and has been conserved throughout eukaryotic evolution. This gene encodes the p20 subunit, which is necessary for actin nucleation and high-affinity binding to F-actin. Alternative splicing results in multiple transcript variants. Naturally occurring read-through transcription exists between this gene and the downstream tubulin tyrosine ligase-like family, member 3 (TTLL3), which results in the production of a fusion protein. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 36 kDa |
AA Sequence : | MRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARPC4 actin related protein 2/3 complex, subunit 4, 20kDa [ Homo sapiens ] |
Official Symbol | ARPC4 |
Synonyms | ARPC4; actin related protein 2/3 complex, subunit 4, 20kDa; actin related protein 2/3 complex, subunit 4 (20 kD); actin-related protein 2/3 complex subunit 4; actin related protein 2/3 complex; subunit 4 (20 kD); ARC20; Arp2/3 protein complex subunit p20; p20 Arc; arp2/3 complex 20 kDa subunit; arp2/3 protein complex subunit p20; P20-ARC; MGC13544; |
Gene ID | 10093 |
mRNA Refseq | NM_001024959 |
Protein Refseq | NP_001020130 |
MIM | 604226 |
UniProt ID | P59998 |
◆ Recombinant Proteins | ||
ARPC4-3088M | Recombinant Mouse ARPC4, His-tagged | +Inquiry |
ARPC4-151H | Recombinant Human ARPC4 Protein, His-tagged | +Inquiry |
Arpc4-3106M | Recombinant Mouse Arpc4, His-tagged | +Inquiry |
ARPC4-8453H | Recombinant Human ARPC4 protein, His-tagged | +Inquiry |
ARPC4-848H | Recombinant Human ARPC4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARPC4-8684HCL | Recombinant Human ARPC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARPC4 Products
Required fields are marked with *
My Review for All ARPC4 Products
Required fields are marked with *
0
Inquiry Basket