Recombinant Human ART4 protein, GST-tagged

• Cat.No.: ART4-301319H
• Product Overview: Recombinant Human ART4 (1-60 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Gly60
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MGPLINRCKKILLPTTVPPATMRIWLLGGLLPFLLLLSGLQRPTEGSEVAIKIDFDFAPG
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: ART4 ADP-ribosyltransferase 4 (Dombrock blood group) [ Homo sapiens ]
• Official Symbol: ART4
• Synonyms: ART4; ADP-ribosyltransferase 4 (Dombrock blood group); ADP ribosyltransferase 4 , ADP ribosyltransferase 4 (DO blood group) , DO, Dombrock blood group; ecto-ADP-ribosyltransferase 4; CD297; DOK1; mono-ADP-ribosyltransferase 4; mono(ADP-ribosyl)transferase 4; Dombrock blood group carrier molecule; ADP-ribosyltransferase 4 (DO blood group); NAD(P)(+)--arginine ADP-ribosyltransferase 4; DO
• Gene ID: 420
• mRNA Refseq: NM_021071
• Protein Refseq: NP_066549
• UniProt ID: Q93070