Recombinant Human ART4 protein, GST-tagged
Cat.No. : | ART4-301319H |
Product Overview : | Recombinant Human ART4 (1-60 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Gly60 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGPLINRCKKILLPTTVPPATMRIWLLGGLLPFLLLLSGLQRPTEGSEVAIKIDFDFAPG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ART4 ADP-ribosyltransferase 4 (Dombrock blood group) [ Homo sapiens ] |
Official Symbol | ART4 |
Synonyms | ART4; ADP-ribosyltransferase 4 (Dombrock blood group); ADP ribosyltransferase 4 , ADP ribosyltransferase 4 (DO blood group) , DO, Dombrock blood group; ecto-ADP-ribosyltransferase 4; CD297; DOK1; mono-ADP-ribosyltransferase 4; mono(ADP-ribosyl)transferase 4; Dombrock blood group carrier molecule; ADP-ribosyltransferase 4 (DO blood group); NAD(P)(+)--arginine ADP-ribosyltransferase 4; DO; |
Gene ID | 420 |
mRNA Refseq | NM_021071 |
Protein Refseq | NP_066549 |
UniProt ID | Q93070 |
◆ Recombinant Proteins | ||
ART4-3890C | Recombinant Chicken ART4 | +Inquiry |
ART4-3374H | Recombinant Human ART4 protein, His-tagged | +Inquiry |
ART4-101H | Recombinant Human ART4 Protein, His-tagged | +Inquiry |
ART4-140C | Recombinant Cynomolgus ART4, Fc tagged | +Inquiry |
ART4-7854H | Recombinant Human ART4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ART4-1194RCL | Recombinant Rat ART4 cell lysate | +Inquiry |
ART4-1541MCL | Recombinant Mouse ART4 cell lysate | +Inquiry |
ART4-925CCL | Recombinant Cynomolgus ART4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ART4 Products
Required fields are marked with *
My Review for All ART4 Products
Required fields are marked with *