Recombinant Human ASF1B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ASF1B-1336H
• Product Overview: ASF1B MS Standard C13 and N15-labeled recombinant protein (NP_060624) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.
• Molecular Mass: 22.4 kDa
• AA Sequence: MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ASF1B anti-silencing function 1B histone chaperone [ Homo sapiens (human) ]
• Official Symbol: ASF1B
• Synonyms: ASF1B; ASF1 anti-silencing function 1 homolog B (S. cerevisiae); histone chaperone ASF1B; FLJ10604; hAsf1; hAsf1b; hCIA-II; CCG1-interacting factor A-II; anti-silencing function protein 1 homolog B; CIA-II
• Gene ID: 55723
• mRNA Refseq: NM_018154
• Protein Refseq: NP_060624
• MIM: 609190
• UniProt ID: Q9NVP2