Recombinant Human ASF1B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ASF1B-1336H
Product Overview : ASF1B MS Standard C13 and N15-labeled recombinant protein (NP_060624) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.
Molecular Mass : 22.4 kDa
AA Sequence : MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ASF1B anti-silencing function 1B histone chaperone [ Homo sapiens (human) ]
Official Symbol ASF1B
Synonyms ASF1B; ASF1 anti-silencing function 1 homolog B (S. cerevisiae); histone chaperone ASF1B; FLJ10604; hAsf1; hAsf1b; hCIA-II; CCG1-interacting factor A-II; anti-silencing function protein 1 homolog B; CIA-II;
Gene ID 55723
mRNA Refseq NM_018154
Protein Refseq NP_060624
MIM 609190
UniProt ID Q9NVP2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASF1B Products

Required fields are marked with *

My Review for All ASF1B Products

Required fields are marked with *

0
cart-icon