Recombinant Human AVP protein, GST-tagged
Cat.No. : | AVP-1043H |
Product Overview : | Human AVP partial ORF (NP_000481.2, 20 a.a. - 124 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | GST |
Protein Length : | 20-124 a.a. |
Description : | This gene encodes a member of the vasopressin/oxytocin family and preproprotein that is proteolytically processed to generate multiple protein products. These products include the neuropeptide hormone arginine vasopressin, and two other peptides, neurophysin 2 and copeptin. Arginine vasopressin is a posterior pituitary hormone that is synthesized in the supraoptic nucleus and paraventricular nucleus of the hypothalamus. Along with its carrier protein, neurophysin 2, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis where it is either stored or secreted into the bloodstream. The precursor is thought to be activated while it is being transported along the axon to the posterior pituitary. Arginine vasopressin acts as a growth factor by enhancing pH regulation through acid-base transport systems. It has a direct antidiuretic action on the kidney, and also causes vasoconstriction of the peripheral vessels. This hormone can contract smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. Mutations in this gene cause autosomal dominant neurohypophyseal diabetes insipidus (ADNDI). This gene is present in a gene cluster with the related gene oxytocin on chromosome 20. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 37.18 kDa |
AA Sequence : | CYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AVP arginine vasopressin [ Homo sapiens ] |
Official Symbol | AVP |
Synonyms | AVP; arginine vasopressin; ARVP; vasopressin-neurophysin 2-copeptin; ADH; antidiuretic hormone; diabetes insipidus; neurohypophyseal; neurophysin II; vasopressin-neurophysin II-copeptin; VP; AVRP; AVP-NPII; |
Gene ID | 551 |
mRNA Refseq | NM_000490 |
Protein Refseq | NP_000481 |
MIM | 192340 |
UniProt ID | P01185 |
◆ Recombinant Proteins | ||
AVP-6740C | Recombinant Chicken AVP | +Inquiry |
AVP-1313H | Recombinant Human AVP Protein (Cys20-Tyr164), N-His tagged | +Inquiry |
Avp-8224R | Recombinant Rat Avp protein, His-tagged | +Inquiry |
AVP-2213M | Recombinant Mouse AVP Protein | +Inquiry |
AVP-1000HFL | Recombinant Full Length Human AVP Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AVP Products
Required fields are marked with *
My Review for All AVP Products
Required fields are marked with *
0
Inquiry Basket