Recombinant Human AVPI1 protein, GST-tagged

Cat.No. : AVPI1-1044H
Product Overview : Human AVPI1 full-length ORF ( NP_068378.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AVPI1 (Arginine Vasopressin Induced 1) is a Protein Coding gene.
Molecular Mass : 43.2 kDa
AA Sequence : MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AVPI1 arginine vasopressin-induced 1 [ Homo sapiens ]
Official Symbol AVPI1
Synonyms VIP32; VIT32; PP5395; RP11-548K23.7
Gene ID 60370
mRNA Refseq NM_021732.2
Protein Refseq NP_068378.2
UniProt ID Q5T686

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AVPI1 Products

Required fields are marked with *

My Review for All AVPI1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon