Recombinant Human AVPI1 protein, GST-tagged
| Cat.No. : | AVPI1-1044H |
| Product Overview : | Human AVPI1 full-length ORF ( NP_068378.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | AVPI1 (Arginine Vasopressin Induced 1) is a Protein Coding gene. |
| Molecular Mass : | 43.2 kDa |
| AA Sequence : | MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AVPI1 arginine vasopressin-induced 1 [ Homo sapiens ] |
| Official Symbol | AVPI1 |
| Synonyms | VIP32; VIT32; PP5395; RP11-548K23.7 |
| Gene ID | 60370 |
| mRNA Refseq | NM_021732.2 |
| Protein Refseq | NP_068378.2 |
| UniProt ID | Q5T686 |
| ◆ Recombinant Proteins | ||
| AVPI1-913M | Recombinant Mouse AVPI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Avpi1-8221R | Recombinant Rat Avpi1 protein, His & T7-tagged | +Inquiry |
| AVPI1-1044H | Recombinant Human AVPI1 protein, GST-tagged | +Inquiry |
| AVPI1-3035H | Recombinant Human AVPI1 Protein, His-tagged | +Inquiry |
| AVPI1-2214M | Recombinant Mouse AVPI1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AVPI1-8558HCL | Recombinant Human AVPI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AVPI1 Products
Required fields are marked with *
My Review for All AVPI1 Products
Required fields are marked with *
